SCOPe 2.06: Domain d1dv4g_: 1dv4 G:

Lineage for d1dv4g_ (1dv4 G:)

1. Root: SCOPe 2.06

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.3: Small subunit [58132] (3 proteins)

6. Protein Prokaryotic (30S subunit) [58133] (1 species)

7. Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries)

8. Domain d1dv4g_: 1dv4 G: [45876]
   complexed with wo2

Details for d1dv4g_

PDB Entry: 1dv4, 4.5 Å

PDB Description: partial structure of 16s rna of the small ribosomal subunit from thermus thermophilus

PDB Compounds: (G:) ribosomal protein s7

SCOPe Domain Sequences for d1dv4g_:

Sequence; same for both SEQRES and ATOM records:

>d1dv4g_ i.1.1.3 (G:) Prokaryotic (30S subunit) {Thermus thermophilus [TaxId: 274]}
lqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkvfkqavenvkp
rmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavriahelmdaaegk
ggavkkkedvermae

Timeline for d1dv4g_:

• d1dv4g_ first appeared (with stable ids) in SCOP 1.55
  
• d1dv4g_ appears in SCOPe 2.05
  
• d1dv4g_ appears in SCOPe 2.07
  
• d1dv4g_ appears in the current release, SCOPe 2.08