Lineage for d1dv4g_ (1dv4 G:)

  1. Root: SCOP 1.67
  2. 432183Class i: Low resolution protein structures [58117] (22 folds)
  3. 432184Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 432185Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 432810Family i.1.1.3: Small subunit [58132] (1 protein)
  6. 432811Protein 30S subunit [58133] (1 species)
  7. 432812Species Thermus thermophilus [TaxId:274] [58134] (4 PDB entries)
  8. 432835Domain d1dv4g_: 1dv4 G: [45876]

Details for d1dv4g_

PDB Entry: 1dv4 (more details), 4.5 Å

PDB Description: partial structure of 16s rna of the small ribosomal subunit from thermus thermophilus

SCOP Domain Sequences for d1dv4g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dv4g_ i.1.1.3 (G:) 30S subunit {Thermus thermophilus}
lqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkvfkqavenvkp
rmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavriahelmdaaegk
ggavkkkedvermae

SCOP Domain Coordinates for d1dv4g_:

Click to download the PDB-style file with coordinates for d1dv4g_.
(The format of our PDB-style files is described here.)

Timeline for d1dv4g_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dv4e_