SCOPe 2.05: Domain d1dv4e_: 1dv4 E:

Lineage for d1dv4e_ (1dv4 E:)

1. Root: SCOPe 2.05

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.3: Small subunit [58132] (3 proteins)

6. Protein Prokaryotic (30S subunit) [58133] (1 species)

7. Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries)

8. Domain d1dv4e_: 1dv4 E: [45875]
   complexed with wo2

Details for d1dv4e_

PDB Entry: 1dv4, 4.5 Å

PDB Description: partial structure of 16s rna of the small ribosomal subunit from thermus thermophilus

PDB Compounds: (E:) ribosomal protein s5

SCOPe Domain Sequences for d1dv4e_:

Sequence; same for both SEQRES and ATOM records:

>d1dv4e_ i.1.1.3 (E:) Prokaryotic (30S subunit) {Thermus thermophilus [TaxId: 274]}
inpnkleleervvavnrvakvvkggrrlrfsalvvvgdknghvgfgtgkaqevpeairka
iedakknlievpivgttiphevighfgageiilkpasegtgviaggparavlelagisdi
lsksigsntpinmvratfdglkqlk

Timeline for d1dv4e_:

• d1dv4e_ first appeared (with stable ids) in SCOP 1.55
  
• d1dv4e_ appears in SCOPe 2.04
  
• d1dv4e_ appears in SCOPe 2.06
  
• d1dv4e_ appears in the current release, SCOPe 2.07