Lineage for d1qd7i_ (1qd7 I:)

  1. Root: SCOP 1.67
  2. 432183Class i: Low resolution protein structures [58117] (22 folds)
  3. 432184Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 432185Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 432810Family i.1.1.3: Small subunit [58132] (1 protein)
  6. 432811Protein 30S subunit [58133] (1 species)
  7. 432812Species Thermus thermophilus [TaxId:274] [58134] (4 PDB entries)
  8. 432844Domain d1qd7i_: 1qd7 I: [45872]

Details for d1qd7i_

PDB Entry: 1qd7 (more details), 5.5 Å

PDB Description: partial model for 30s ribosomal subunit

SCOP Domain Sequences for d1qd7i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qd7i_ i.1.1.3 (I:) 30S subunit {Thermus thermophilus}
qrkvyvgrvvsdkmdktitvlvetykkhplygkrvkyskkykahdehneakvgdivkime
trplsatkrfrlveivekavragagagaa

SCOP Domain Coordinates for d1qd7i_:

Click to download the PDB-style file with coordinates for d1qd7i_.
(The format of our PDB-style files is described here.)

Timeline for d1qd7i_: