Lineage for d1qd7f_ (1qd7 F:)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1070814Family i.1.1.3: Small subunit [58132] (1 protein)
  6. 1070815Protein 30S subunit [58133] (1 species)
  7. 1070816Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries)
  8. 1070849Domain d1qd7f_: 1qd7 F: [45869]

Details for d1qd7f_

PDB Entry: 1qd7 (more details), 5.5 Å

PDB Description: partial model for 30s ribosomal subunit
PDB Compounds: (F:) s7 ribosomal protein

SCOPe Domain Sequences for d1qd7f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qd7f_ i.1.1.3 (F:) 30S subunit {Thermus thermophilus [TaxId: 274]}
lqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkvfkqavenvkp
rmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavriahelmdaaegk
ggavkkkedvermae

SCOPe Domain Coordinates for d1qd7f_:

Click to download the PDB-style file with coordinates for d1qd7f_.
(The format of our PDB-style files is described here.)

Timeline for d1qd7f_: