SCOP 1.75: Domain d1qd7f_: 1qd7 F:

Lineage for d1qd7f_ (1qd7 F:)

1. Root: SCOP 1.75

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.3: Small subunit [58132] (1 protein)

6. Protein 30S subunit [58133] (1 species)

7. Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries)

8. Domain d1qd7f_: 1qd7 F: [45869]

Details for d1qd7f_

PDB Entry: 1qd7, 5.5 Å

PDB Description: partial model for 30s ribosomal subunit

PDB Compounds: (F:) s7 ribosomal protein

SCOP Domain Sequences for d1qd7f_:

Sequence; same for both SEQRES and ATOM records:

>d1qd7f_ i.1.1.3 (F:) 30S subunit {Thermus thermophilus [TaxId: 274]}
lqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkvfkqavenvkp
rmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavriahelmdaaegk
ggavkkkedvermae

Timeline for d1qd7f_:

• d1qd7f_ first appeared (with stable ids) in SCOP 1.55
  
• d1qd7f_ appears in SCOP 1.73
  
• d1qd7f_ appears in SCOPe 2.01
  
• d1qd7f_ appears in the current release, SCOPe 2.08