Lineage for d1qd7e_ (1qd7 E:)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1970698Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1970699Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1972283Family i.1.1.3: Small subunit [58132] (3 proteins)
  6. 1972361Protein Prokaryotic (30S subunit) [58133] (1 species)
  7. 1972362Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries)
  8. 1972394Domain d1qd7e_: 1qd7 E: [45868]

Details for d1qd7e_

PDB Entry: 1qd7 (more details), 5.5 Å

PDB Description: partial model for 30s ribosomal subunit
PDB Compounds: (E:) s6 ribosomal protein

SCOPe Domain Sequences for d1qd7e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qd7e_ i.1.1.3 (E:) Prokaryotic (30S subunit) {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepf

SCOPe Domain Coordinates for d1qd7e_:

Click to download the PDB-style file with coordinates for d1qd7e_.
(The format of our PDB-style files is described here.)

Timeline for d1qd7e_: