Lineage for d1fkao_ (1fka O:)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1970698Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1970699Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1972283Family i.1.1.3: Small subunit [58132] (3 proteins)
  6. 1972361Protein Prokaryotic (30S subunit) [58133] (1 species)
  7. 1972362Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries)
  8. 1972382Domain d1fkao_: 1fka O: [45858]
    protein/RNA complex; complexed with wo2

Details for d1fkao_

PDB Entry: 1fka (more details), 3.3 Å

PDB Description: structure of functionally activated small ribosomal subunit at 3.3 a resolution
PDB Compounds: (O:) 30S ribosomal protein S15

SCOPe Domain Sequences for d1fkao_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fkao_ i.1.1.3 (O:) Prokaryotic (30S subunit) {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyreiveklglrg

SCOPe Domain Coordinates for d1fkao_:

Click to download the PDB-style file with coordinates for d1fkao_.
(The format of our PDB-style files is described here.)

Timeline for d1fkao_: