Lineage for d1fkao_ (1fka O:)

  1. Root: SCOP 1.73
  2. 753709Class i: Low resolution protein structures [58117] (26 folds)
  3. 753710Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 753711Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 754598Family i.1.1.3: Small subunit [58132] (1 protein)
  6. 754599Protein 30S subunit [58133] (1 species)
  7. 754600Species Thermus thermophilus [TaxId:274] [58134] (4 PDB entries)
  8. 754614Domain d1fkao_: 1fka O: [45858]

Details for d1fkao_

PDB Entry: 1fka (more details), 3.3 Å

PDB Description: structure of functionally activated small ribosomal subunit at 3.3 a resolution
PDB Compounds: (O:) 30S ribosomal protein S15

SCOP Domain Sequences for d1fkao_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fkao_ i.1.1.3 (O:) 30S subunit {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyreiveklglrg

SCOP Domain Coordinates for d1fkao_:

Click to download the PDB-style file with coordinates for d1fkao_.
(The format of our PDB-style files is described here.)

Timeline for d1fkao_: