Class i: Low resolution protein structures [58117] (26 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.3: Small subunit [58132] (1 protein) |
Protein 30S subunit [58133] (1 species) |
Species Thermus thermophilus [TaxId:274] [58134] (4 PDB entries) |
Domain d1fkao_: 1fka O: [45858] |
PDB Entry: 1fka (more details), 3.3 Å
SCOP Domain Sequences for d1fkao_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fkao_ i.1.1.3 (O:) 30S subunit {Thermus thermophilus [TaxId: 274]} pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg qrrrllrylqredperyreiveklglrg
Timeline for d1fkao_: