SCOP 1.57: Domain d1fkah_: 1fka H:

Lineage for d1fkah_ (1fka H:)

1. Root: SCOP 1.57
2. Class i: Low resolution protein structures [58117] (15 folds)
3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)
5. Family i.1.1.3: Small subunit [58132] (1 protein)
6. Protein 30S subunit [58133] (1 species)
7. Species Thermus thermophilus [TaxId:274] [58134] (4 PDB entries)
8. Domain d1fkah_: 1fka H: [45851]

Details for d1fkah_

PDB Entry: 1fka, 3.3 Å

PDB Description: structure of functionally activated small ribosomal subunit at 3.3 a resolution

SCOP Domain Sequences for d1fkah_:

Sequence; same for both SEQRES and ATOM records:

>d1fkah_ i.1.1.3 (H:) 30S subunit {Thermus thermophilus}
tdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylrvy
lkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvltdr
earklgvggelicevw

SCOP Domain Coordinates for d1fkah_ are not available.

Timeline for d1fkah_:

• d1fkah_ first appeared (with stable ids) in SCOP 1.55
  
• d1fkah_ appears in SCOP 1.59
  
• d1fkah_ appears in the current release, SCOPe 2.08