Lineage for d1fkag_ (1fka G:)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1711644Family i.1.1.3: Small subunit [58132] (2 proteins)
  6. 1711645Protein 30S subunit [58133] (1 species)
  7. 1711646Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries)
  8. 1711659Domain d1fkag_: 1fka G: [45850]
    protein/RNA complex; complexed with wo2

Details for d1fkag_

PDB Entry: 1fka (more details), 3.3 Å

PDB Description: structure of functionally activated small ribosomal subunit at 3.3 a resolution
PDB Compounds: (G:) 30S ribosomal protein S7

SCOPe Domain Sequences for d1fkag_:

Sequence, based on SEQRES records: (download)

>d1fkag_ i.1.1.3 (G:) 30S subunit {Thermus thermophilus [TaxId: 274]}
rrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkvf
kqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavriah
elmdaaegkggavkkkedvermae

Sequence, based on observed residues (ATOM records): (download)

>d1fkag_ i.1.1.3 (G:) 30S subunit {Thermus thermophilus [TaxId: 274]}
rrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkvf
kqavenvkprmevsprrqqslalrwlvqaanqrperraavriahelmdaaegkggavkkk
edvermae

SCOPe Domain Coordinates for d1fkag_:

Click to download the PDB-style file with coordinates for d1fkag_.
(The format of our PDB-style files is described here.)

Timeline for d1fkag_: