Lineage for d1fkag_ (1fka G:)

  1. Root: SCOP 1.55
  2. Class i: Low resolution protein structures [58117] (12 folds)
  3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. Family i.1.1.3: Small subunit [58132] (1 protein)
  6. Protein 30S subunit [58133] (1 species)
  7. Species Thermus thermophilus [TaxId:274] [58134] (4 PDB entries)
  8. Domain d1fkag_: 1fka G: [45850]

Details for d1fkag_

PDB Entry: 1fka (more details), 3.3 Å

PDB Description: structure of functionally activated small ribosomal subunit at 3.3 a resolution
PDB Compounds: (G:)

SCOP Domain Sequences for d1fkag_:

Sequence, based on SEQRES records: (download)

>d1fkag_ i.1.1.3 (G:) 30S subunit {Thermus thermophilus}
rrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkvf
kqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavriah
elmdaaegkggavkkkedvermae

Sequence, based on observed residues (ATOM records): (download)

>d1fkag_ i.1.1.3 (G:) 30S subunit {Thermus thermophilus}
rrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkvf
kqavenvkprmevsprrqqslalrwlvqaanqrperraavriahelmdaaegkggavkkk
edvermae

SCOP Domain Coordinates for d1fkag_ are not available.

Timeline for d1fkag_: