SCOPe 2.05: Domain d1fkaf

Lineage for d1fkaf_ (1fka F:)

Root: SCOPe 2.05
Class i: Low resolution protein structures [58117] (25 folds)
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)
Family i.1.1.3: Small subunit [58132] (3 proteins)
Protein Prokaryotic (30S subunit) [58133] (1 species)
Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries)
Domain d1fkaf_: 1fka F: [45849]
protein/RNA complex; complexed with wo2

Details for d1fkaf_

PDB Entry: 1fka (more details), 3.3 Å

PDB Description: structure of functionally activated small ribosomal subunit at 3.3 a resolution

PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d1fkaf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fkaf_ i.1.1.3 (F:) Prokaryotic (30S subunit) {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepf

SCOPe Domain Coordinates for d1fkaf_:

Click to download the PDB-style file with coordinates for d1fkaf_.
(The format of our PDB-style files is described here.)

Timeline for d1fkaf_:

d1fkaf_ first appeared (with stable ids) in SCOP 1.55
d1fkaf_ appears in SCOPe 2.04
d1fkaf_ appears in SCOPe 2.06
d1fkaf_ appears in the current release, SCOPe 2.08