Lineage for d1fkae_ (1fka E:)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1711644Family i.1.1.3: Small subunit [58132] (2 proteins)
  6. 1711645Protein 30S subunit [58133] (1 species)
  7. 1711646Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries)
  8. 1711657Domain d1fkae_: 1fka E: [45848]
    protein/RNA complex; complexed with wo2

Details for d1fkae_

PDB Entry: 1fka (more details), 3.3 Å

PDB Description: structure of functionally activated small ribosomal subunit at 3.3 a resolution
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d1fkae_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fkae_ i.1.1.3 (E:) 30S subunit {Thermus thermophilus [TaxId: 274]}
mpetdfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagy
yarrnmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdilt
kelgsrnpiniayatmealrqlrtkadverlrkgeah

SCOPe Domain Coordinates for d1fkae_:

Click to download the PDB-style file with coordinates for d1fkae_.
(The format of our PDB-style files is described here.)

Timeline for d1fkae_: