Lineage for d1fkae_ (1fka E:)

  1. Root: SCOP 1.69
  2. 526321Class i: Low resolution protein structures [58117] (24 folds)
  3. 526322Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 526323Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 527059Family i.1.1.3: Small subunit [58132] (1 protein)
  6. 527060Protein 30S subunit [58133] (1 species)
  7. 527061Species Thermus thermophilus [TaxId:274] [58134] (4 PDB entries)
  8. 527066Domain d1fkae_: 1fka E: [45848]

Details for d1fkae_

PDB Entry: 1fka (more details), 3.3 Å

PDB Description: structure of functionally activated small ribosomal subunit at 3.3 a resolution

SCOP Domain Sequences for d1fkae_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fkae_ i.1.1.3 (E:) 30S subunit {Thermus thermophilus}
mpetdfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagy
yarrnmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdilt
kelgsrnpiniayatmealrqlrtkadverlrkgeah

SCOP Domain Coordinates for d1fkae_:

Click to download the PDB-style file with coordinates for d1fkae_.
(The format of our PDB-style files is described here.)

Timeline for d1fkae_: