Class i: Low resolution protein structures [58117] (24 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.2: Large subunit [58124] (3 proteins) |
Protein 50S subunit [58125] (3 species) |
Species Escherichia coli [TaxId:562] [58127] (1 PDB entry) |
Domain d487dn_: 487d N: [45841] |
PDB Entry: 487d (more details), 7.5 Å
SCOP Domain Sequences for d487dn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d487dn_ i.1.1.2 (N:) 50S subunit {Escherichia coli} mftinaevrkeqgkgasrrlraankfpaiiyggkeaplaieldhdkvmnmqakaefysev ltivvdgkeikvkaqdvqrhpykpklqhidfvra
Timeline for d487dn_: