Lineage for d487dk_ (487d K:)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1711204Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1711205Protein 50S subunit [58125] (6 species)
  7. 1711346Species Escherichia coli [TaxId:562] [58127] (1 PDB entry)
  8. 1711350Domain d487dk_: 487d K: [45838]
    complexed with fmt, nh2

Details for d487dk_

PDB Entry: 487d (more details), 7.5 Å

PDB Description: seven ribosomal proteins fitted to a cryo-electron microscopic map of the large 50s subunit at 7.5 angstroms resolution
PDB Compounds: (K:) protein (50s l9 ribosomal protein)

SCOPe Domain Sequences for d487dk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d487dk_ i.1.1.2 (K:) 50S subunit {Escherichia coli [TaxId: 562]}
mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqkqkeqrqaae
elanakklkeqlekltvtipakageggrlfgsitskqiaeslqaqhglkldkrkielada
iralgytnvpvklhpevtatlkvhvteqk

SCOPe Domain Coordinates for d487dk_:

Click to download the PDB-style file with coordinates for d487dk_.
(The format of our PDB-style files is described here.)

Timeline for d487dk_: