Lineage for d487dk_ (487d K:)

  1. Root: SCOP 1.67
  2. 432183Class i: Low resolution protein structures [58117] (22 folds)
  3. 432184Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 432185Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 432659Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 432663Protein 50S subunit [58125] (3 species)
  7. 432799Species Escherichia coli [TaxId:562] [58127] (1 PDB entry)
  8. 432803Domain d487dk_: 487d K: [45838]

Details for d487dk_

PDB Entry: 487d (more details), 7.5 Å

PDB Description: seven ribosomal proteins fitted to a cryo-electron microscopic map of the large 50s subunit at 7.5 angstroms resolution

SCOP Domain Sequences for d487dk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d487dk_ i.1.1.2 (K:) 50S subunit {Escherichia coli}
mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqkqkeqrqaae
elanakklkeqlekltvtipakageggrlfgsitskqiaeslqaqhglkldkrkielada
iralgytnvpvklhpevtatlkvhvteqk

SCOP Domain Coordinates for d487dk_:

Click to download the PDB-style file with coordinates for d487dk_.
(The format of our PDB-style files is described here.)

Timeline for d487dk_: