Lineage for d487dj_ (487d J:)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1070374Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1070375Protein 50S subunit [58125] (6 species)
  7. 1070516Species Escherichia coli [TaxId:562] [58127] (1 PDB entry)
  8. 1070519Domain d487dj_: 487d J: [45837]
    complexed with fmt, nh2

Details for d487dj_

PDB Entry: 487d (more details), 7.5 Å

PDB Description: seven ribosomal proteins fitted to a cryo-electron microscopic map of the large 50s subunit at 7.5 angstroms resolution
PDB Compounds: (J:) protein (50s l6 ribosomal protein)

SCOPe Domain Sequences for d487dj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d487dj_ i.1.1.2 (J:) 50S subunit {Escherichia coli [TaxId: 562]}
pieipagvtvtvngntvtvkgpkgeltrtfhpdmtitvegnvitvtrpsdekhhralhgt
trsllanmvegvskgyekalelvgvgyraskqgkklvlsvgyshpveiepeegleievps
qtkiivkgadkqrvgelaaniravrppepykgkgiryegelvrl

SCOPe Domain Coordinates for d487dj_:

Click to download the PDB-style file with coordinates for d487dj_.
(The format of our PDB-style files is described here.)

Timeline for d487dj_: