| Class i: Low resolution protein structures [58117] (25 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.2: Large subunit [58124] (3 proteins) |
| Protein Prokaryotic (50S subunit) [58125] (3 species) |
| Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
| Domain d1c04a_: 1c04 A: [45827] |
PDB Entry: 1c04 (more details), 5 Å
SCOPe Domain Sequences for d1c04a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c04a_ i.1.1.2 (A:) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
qyriidfkrdkdgipgrvatieydpnrsanialinyadgekryiiapknlkvgmeimsgp
dadikignalplenipvgtlvhnielkpgrggqlvraagtsaqvlgkegkyvivrlasge
vrmilgkcratvgev
Timeline for d1c04a_: