Lineage for d1c04a_ (1c04 A:)

  1. Root: SCOP 1.55
  2. Class i: Low resolution protein structures [58117] (12 folds)
  3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. Protein 50S subunit [58125] (2 species)
  7. Species Haloarcula marismortui [TaxId:2238] [58126] (3 PDB entries)
  8. Domain d1c04a_: 1c04 A: [45827]

Details for d1c04a_

PDB Entry: 1c04 (more details), 5 Å

PDB Description: identification of known protein and rna structures in a 5 a map of the large ribosomal subunit from haloarcula marismortui
PDB Compounds: (A:)

SCOP Domain Sequences for d1c04a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c04a_ i.1.1.2 (A:) 50S subunit {Haloarcula marismortui}
qyriidfkrdkdgipgrvatieydpnrsanialinyadgekryiiapknlkvgmeimsgp
dadikignalplenipvgtlvhnielkpgrggqlvraagtsaqvlgkegkyvivrlasge
vrmilgkcratvgev

SCOP Domain Coordinates for d1c04a_ are not available.

Timeline for d1c04a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1c04b_, d1c04c_, d1c04d_, d1c04e_, d1c04f_