SCOP 1.71: Domain d1eg0k_: 1eg0 K:

Lineage for d1eg0k_ (1eg0 K:)

1. Root: SCOP 1.71

2. Class i: Low resolution protein structures [58117] (24 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (3 species)

7. Species Escherichia coli [TaxId:562] [58123] (39 PDB entries)

8. Domain d1eg0k_: 1eg0 K: [45817]

Details for d1eg0k_

PDB Entry: 1eg0

PDB Description: fitting of components with known structure into an 11.5 a cryo-em map of the e.coli 70s ribosome

SCOP Domain Sequences for d1eg0k_:

Sequence; same for both SEQRES and ATOM records:

>d1eg0k_ i.1.1.1 (K:) 70S ribosome functional complex {Escherichia coli}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
iegtaksmgievv

Timeline for d1eg0k_:

• d1eg0k_ first appeared (with stable ids) in SCOP 1.55
  
• d1eg0k_ appears in SCOP 1.69
  
• d1eg0k_ appears in SCOP 1.73
  
• d1eg0k_ appears in the current release, SCOPe 2.08