Lineage for d1eg0j_ (1eg0 J:)

  1. Root: SCOP 1.71
  2. 627044Class i: Low resolution protein structures [58117] (24 folds)
  3. 627045Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 627046Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 627047Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 627048Protein 70S ribosome functional complex [58121] (3 species)
  7. 627097Species Escherichia coli [TaxId:562] [58123] (39 PDB entries)
  8. 627305Domain d1eg0j_: 1eg0 J: [45816]

Details for d1eg0j_

PDB Entry: 1eg0 (more details)

PDB Description: fitting of components with known structure into an 11.5 a cryo-em map of the e.coli 70s ribosome

SCOP Domain Sequences for d1eg0j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eg0j_ i.1.1.1 (J:) 70S ribosome functional complex {Escherichia coli}
pieipagvtvtvngntvtvkgpkgeltrtfhpdmtitvegnvitvtrpsdekhhralhgt
trsllanmvegvskgyekalelvgvgyraskqgkklvlsvgyshpveiepeegleievps
qtkiivkgadkqrvgelaaniravrppepykgkgiryegelvrl

SCOP Domain Coordinates for d1eg0j_:

Click to download the PDB-style file with coordinates for d1eg0j_.
(The format of our PDB-style files is described here.)

Timeline for d1eg0j_: