SCOP 1.73: Domain d1eg0b_: 1eg0 B:

Lineage for d1eg0b_ (1eg0 B:)

1. Root: SCOP 1.73

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (3 species)

7. Species Escherichia coli [TaxId:562] [58123] (34 PDB entries)

8. Domain d1eg0b_: 1eg0 B: [45808]

Details for d1eg0b_

PDB Entry: 1eg0

PDB Description: fitting of components with known structure into an 11.5 a cryo-em map of the e.coli 70s ribosome

PDB Compounds: (B:) protein (s5 ribosomal protein)

SCOP Domain Sequences for d1eg0b_:

Sequence; same for both SEQRES and ATOM records:

>d1eg0b_ i.1.1.1 (B:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
inpnkleleervvavnrvakvvkggrrlrfsalvvvgdknghvgfgtgkaqevpeairka
iedakknlievpivgttiphevighfgageiilkpasegtgviaggparavlelagisdi
lsksigsntpinmvratfdglkqlk

Timeline for d1eg0b_:

• d1eg0b_ first appeared (with stable ids) in SCOP 1.55
  
• d1eg0b_ appears in SCOP 1.71
  
• d1eg0b_ appears in SCOP 1.75
  
• d1eg0b_ appears in the current release, SCOPe 2.08