Lineage for d1av1c1 (1av1 C:44-243)

  1. Root: SCOPe 2.08
  2. Class h: Coiled coil proteins [57942] (7 folds)
  3. Fold h.5: Apolipoprotein A-I [58112] (1 superfamily)
    tetrameric antiparallel coiled coil, closed in a circuit
  4. Superfamily h.5.1: Apolipoprotein A-I [58113] (1 family) (S)
  5. Family h.5.1.1: Apolipoprotein A-I [58114] (2 proteins)
  6. Protein Apolipoprotein A-I [58115] (1 species)
    individual chains can form an up-and-down bundles
  7. Species Human (Homo sapiens) [TaxId:9606] [58116] (1 PDB entry)
  8. Domain d1av1c1: 1av1 C:44-243 [45798]
    Other proteins in same PDB: d1av1a2, d1av1b2, d1av1c2, d1av1d2

Details for d1av1c1

PDB Entry: 1av1 (more details), 4 Å

PDB Description: crystal structure of human apolipoprotein a-i
PDB Compounds: (C:) apolipoprotein a-I

SCOPe Domain Sequences for d1av1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1av1c1 h.5.1.1 (C:44-243) Apolipoprotein A-I {Human (Homo sapiens) [TaxId: 9606]}
lklldnwdsvtstfsklreqlgpvtqefwdnleketeglrqemskdleevkakvqpyldd
fqkkwqeemelyrqkveplraelqegarqklhelqeklsplgeemrdrarahvdalrthl
apysdelrqrlaarlealkenggarlaeyhakatehlstlsekakpaledlrqgllpvle
sfkvsflsaleeytkklntq

SCOPe Domain Coordinates for d1av1c1 are not available.

Timeline for d1av1c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1av1c2
View in 3D
Domains from other chains:
(mouse over for more information)
d1av1a1, d1av1a2, d1av1b1, d1av1b2, d1av1d1, d1av1d2