Lineage for d1av1b_ (1av1 B:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2647048Fold h.5: Apolipoprotein A-I [58112] (1 superfamily)
    tetrameric antiparallel coiled coil, closed in a circuit
  4. 2647049Superfamily h.5.1: Apolipoprotein A-I [58113] (1 family) (S)
  5. 2647050Family h.5.1.1: Apolipoprotein A-I [58114] (2 proteins)
  6. 2647051Protein Apolipoprotein A-I [58115] (1 species)
    individual chains can form an up-and-down bundles
  7. 2647052Species Human (Homo sapiens) [TaxId:9606] [58116] (1 PDB entry)
  8. 2647054Domain d1av1b_: 1av1 B: [45797]

Details for d1av1b_

PDB Entry: 1av1 (more details), 4 Å

PDB Description: crystal structure of human apolipoprotein a-i
PDB Compounds: (B:) apolipoprotein a-I

SCOPe Domain Sequences for d1av1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1av1b_ h.5.1.1 (B:) Apolipoprotein A-I {Human (Homo sapiens) [TaxId: 9606]}
mlklldnwdsvtstfsklreqlgpvtqefwdnleketeglrqemskdleevkakvqpyld
dfqkkwqeemelyrqkveplraelqegarqklhelqeklsplgeemrdrarahvdalrth
lapysdelrqrlaarlealkenggarlaeyhakatehlstlsekakpaledlrqgllpvl
esfkvsflsaleeytkklntq

SCOPe Domain Coordinates for d1av1b_:

Click to download the PDB-style file with coordinates for d1av1b_.
(The format of our PDB-style files is described here.)

Timeline for d1av1b_: