Lineage for d1av1a_ (1av1 A:)

  1. Root: SCOP 1.55
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.5: Apolipoprotein A-i [58112] (1 superfamily)
  4. Superfamily h.5.1: Apolipoprotein A-i [58113] (1 family) (S)
  5. Family h.5.1.1: Apolipoprotein A-i [58114] (1 protein)
  6. Protein Apolipoprotein A-i [58115] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [58116] (1 PDB entry)
  8. Domain d1av1a_: 1av1 A: [45796]

Details for d1av1a_

PDB Entry: 1av1 (more details), 4 Å

PDB Description: crystal structure of human apolipoprotein a-i

SCOP Domain Sequences for d1av1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1av1a_ h.5.1.1 (A:) Apolipoprotein A-i {Human (Homo sapiens)}
mlklldnwdsvtstfsklreqlgpvtqefwdnleketeglrqemskdleevkakvqpyld
dfqkkwqeemelyrqkveplraelqegarqklhelqeklsplgeemrdrarahvdalrth
lapysdelrqrlaarlealkenggarlaeyhakatehlstlsekakpaledlrqgllpvl
esfkvsflsaleeytkklntq

SCOP Domain Coordinates for d1av1a_ are not available.

Timeline for d1av1a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1av1b_, d1av1c_, d1av1d_