Lineage for d1g2c.b (1g2c U:,V:)

  1. Root: SCOP 1.55
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
  4. Superfamily h.3.2: Virus ectodomain [58069] (1 family) (S)
  5. Family h.3.2.1: Virus ectodomain [58070] (5 proteins)
  6. Protein HRSV fusion protein core [58080] (1 species)
  7. Species Human respiratory syncytial virus [TaxId:11250] [58081] (1 PDB entry)
  8. Domain d1g2c.b: 1g2c U:,V: [45777]

Details for d1g2c.b

PDB Entry: 1g2c (more details), 2.3 Å

PDB Description: human respiratory syncytial virus fusion protein core

SCOP Domain Sequences for d1g2c.b:

Sequence; same for both SEQRES and ATOM records: (download)

>g1g2c.b h.3.2.1 (U:,V:) HRSV fusion protein core {Human respiratory syncytial virus}
legevnkiksallstnkavvslsngvsvltskvldlknyidkqllpivnkXplvfpsdef
dasisqvnekinqslafirksdellhnvn

SCOP Domain Coordinates for d1g2c.b are not available.

Timeline for d1g2c.b: