SCOP 1.63: Domain d1g2c.8: 1g2c O:,P:

Lineage for d1g2c.8 (1g2c O:,P:)

1. Root: SCOP 1.63

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.2: Virus ectodomain [58069] (1 family)

5. Family h.3.2.1: Virus ectodomain [58070] (6 proteins)

6. Protein HRSV fusion protein core [58080] (1 species)

7. Species Human respiratory syncytial virus [TaxId:11250] [58081] (1 PDB entry)

8. Domain d1g2c.8: 1g2c O:,P: [45774]

Details for d1g2c.8

PDB Entry: 1g2c, 2.3 Å

PDB Description: human respiratory syncytial virus fusion protein core

SCOP Domain Sequences for d1g2c.8:

Sequence; same for both SEQRES and ATOM records:

>g1g2c.8 h.3.2.1 (O:,P:) HRSV fusion protein core {Human respiratory syncytial virus}
lhlegevnkiksallstnkavvslsngvsvltskvldlknyidkqllpivXplvfpsdef
dasisqvnekinqslafirksdellhnv

Timeline for d1g2c.8:

• d1g2c.8 first appeared (with stable ids) in SCOP 1.55
  
• d1g2c.8 appears in SCOP 1.61
  
• d1g2c.8 appears in SCOP 1.65
  
• d1g2c.8 appears in the current release, SCOPe 2.08