SCOPe 2.07: Domain d1g2c.6: 1g2c K:,L:

Lineage for d1g2c.6 (1g2c K:,L:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.2: Virus ectodomain [58069] (2 families)

5. Family h.3.2.1: Virus ectodomain [58070] (9 proteins)

6. Protein HRSV fusion protein core [58080] (1 species)

7. Species Human respiratory syncytial virus [TaxId:11250] [58081] (1 PDB entry)

8. Domain d1g2c.6: 1g2c K:,L: [45772]

Details for d1g2c.6

PDB Entry: 1g2c, 2.3 Å

PDB Description: human respiratory syncytial virus fusion protein core

PDB Compounds: (K:) fusion protein (f), (L:) fusion protein (f)

SCOPe Domain Sequences for d1g2c.6:

Sequence; same for both SEQRES and ATOM records:

>g1g2c.6 h.3.2.1 (K:,L:) HRSV fusion protein core {Human respiratory syncytial virus [TaxId: 11250]}
gevnkiksallstnkavvslsngvsvltskvldlknyidkqllpivnkXfydplvfpsde
fdasisqvnekinqslafirksdellhnv

Timeline for d1g2c.6:

• d1g2c.6 first appeared (with stable ids) in SCOP 1.55
  
• d1g2c.6 appears in SCOPe 2.06
  
• d1g2c.6 appears in the current release, SCOPe 2.08