SCOP 1.55: Domain d1g2c.6: 1g2c K:,L:

Lineage for d1g2c.6 (1g2c K:,L:)

1. Root: SCOP 1.55
2. Class h: Coiled coil proteins [57942] (5 folds)
3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
4. Superfamily h.3.2: Virus ectodomain [58069] (1 family)
5. Family h.3.2.1: Virus ectodomain [58070] (5 proteins)
6. Protein HRSV fusion protein core [58080] (1 species)
7. Species Human respiratory syncytial virus [TaxId:11250] [58081] (1 PDB entry)
8. Domain d1g2c.6: 1g2c K:,L: [45772]

Details for d1g2c.6

PDB Entry: 1g2c, 2.3 Å

PDB Description: human respiratory syncytial virus fusion protein core

SCOP Domain Sequences for d1g2c.6:

Sequence; same for both SEQRES and ATOM records:

>g1g2c.6 h.3.2.1 (K:,L:) HRSV fusion protein core {Human respiratory syncytial virus}
gevnkiksallstnkavvslsngvsvltskvldlknyidkqllpivnkXfydplvfpsde
fdasisqvnekinqslafirksdellhnv

SCOP Domain Coordinates for d1g2c.6 are not available.

Timeline for d1g2c.6:

• d1g2c.6 appears in SCOP 1.57
  
• d1g2c.6 appears in the current release, SCOPe 2.08