SCOP 1.59: Domain d1g2c.5: 1g2c I:,J:

Lineage for d1g2c.5 (1g2c I:,J:)

1. Root: SCOP 1.59

2. Class h: Coiled coil proteins [57942] (5 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)

4. Superfamily h.3.2: Virus ectodomain [58069] (1 family)

5. Family h.3.2.1: Virus ectodomain [58070] (6 proteins)

6. Protein HRSV fusion protein core [58080] (1 species)

7. Species Human respiratory syncytial virus [TaxId:11250] [58081] (1 PDB entry)

8. Domain d1g2c.5: 1g2c I:,J: [45771]

Details for d1g2c.5

PDB Entry: 1g2c, 2.3 Å

PDB Description: human respiratory syncytial virus fusion protein core

SCOP Domain Sequences for d1g2c.5:

Sequence; same for both SEQRES and ATOM records:

>g1g2c.5 h.3.2.1 (I:,J:) HRSV fusion protein core {Human respiratory syncytial virus}
hlegevnkiksallstnkavvslsngvsvltskvldlknyidkqllpivnXplvfpsdef
dasisqvnekinqslafirksdellhn

Timeline for d1g2c.5:

• d1g2c.5 first appeared (with stable ids) in SCOP 1.55
  
• d1g2c.5 appears in SCOP 1.57
  
• d1g2c.5 appears in SCOP 1.61
  
• d1g2c.5 appears in the current release, SCOPe 2.08