Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.2: Virus ectodomain [58069] (2 families) |
Family h.3.2.1: Virus ectodomain [58070] (9 proteins) |
Protein HRSV fusion protein core [58080] (1 species) |
Species Human respiratory syncytial virus [TaxId:11250] [58081] (1 PDB entry) |
Domain d1g2c.1: 1g2c A:,B: [45767] |
PDB Entry: 1g2c (more details), 2.3 Å
SCOPe Domain Sequences for d1g2c.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1g2c.1 h.3.2.1 (A:,B:) HRSV fusion protein core {Human respiratory syncytial virus [TaxId: 11250]} legevnkiksallstnkavvslsngvsvltskvldlknyidkqllpivnkXplvfpsdef dasisqvnekinqslafirksdellhnvnag
Timeline for d1g2c.1:
View in 3D Domains from other chains: (mouse over for more information) d1g2c.2, d1g2c.2, d1g2c.2, d1g2c.2, d1g2c.3, d1g2c.3, d1g2c.3, d1g2c.3, d1g2c.4, d1g2c.4, d1g2c.4, d1g2c.4, d1g2c.5, d1g2c.5, d1g2c.5, d1g2c.5, d1g2c.6, d1g2c.6, d1g2c.6, d1g2c.6, d1g2c.7, d1g2c.7, d1g2c.7, d1g2c.7, d1g2c.8, d1g2c.8, d1g2c.8, d1g2c.8, d1g2c.9, d1g2c.9, d1g2c.9, d1g2c.9, d1g2c.a, d1g2c.a, d1g2c.a, d1g2c.a, d1g2c.b, d1g2c.b, d1g2c.b, d1g2c.b, d1g2c.c, d1g2c.c, d1g2c.c, d1g2c.c |