Class h: Coiled coil proteins [57942] (6 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (2 superfamilies) core: trimeric coiled coil |
Superfamily h.3.2: Virus ectodomain [58069] (1 family) |
Family h.3.2.1: Virus ectodomain [58070] (6 proteins) |
Protein Core structure of Ebo gp2 [58076] (1 species) |
Species Ebola virus [TaxId:205488] [58077] (2 PDB entries) |
Domain d1ebof_: 1ebo F: [45762] chimeric, contains a fragment of gcn4 zipper at the N-terminus (res. 1-29) |
PDB Entry: 1ebo (more details), 3 Å
SCOP Domain Sequences for d1ebof_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ebof_ h.3.2.1 (F:) Core structure of Ebo gp2 {Ebola virus} qiedkieeilskiyhieneiarikkligeadglieglrqlanettqalqlflrattelrt fsilnrkaidfllqrwggtchilgpdcriephdwtknitdkidqiihdfvdkt
Timeline for d1ebof_: