SCOP 1.57: Domain d1ebof_: 1ebo F:

Lineage for d1ebof_ (1ebo F:)

1. Root: SCOP 1.57
2. Class h: Coiled coil proteins [57942] (5 folds)
3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
4. Superfamily h.3.2: Virus ectodomain [58069] (1 family)
5. Family h.3.2.1: Virus ectodomain [58070] (5 proteins)
6. Protein Core structure of Ebo gp2 [58076] (1 species)
7. Species Ebola virus [TaxId:205488] [58077] (2 PDB entries)
8. Domain d1ebof_: 1ebo F: [45762]

Details for d1ebof_

PDB Entry: 1ebo, 3 Å

PDB Description: crystal structure of the ebola virus membrane-fusion subunit, gp2, from the envelope glycoprotein ectodomain

SCOP Domain Sequences for d1ebof_:

Sequence; same for both SEQRES and ATOM records:

>d1ebof_ h.3.2.1 (F:) Core structure of Ebo gp2 {Ebola virus}
qiedkieeilskiyhieneiarikkligeadglieglrqlanettqalqlflrattelrt
fsilnrkaidfllqrwggtchilgpdcriephdwtknitdkidqiihdfvdkt

SCOP Domain Coordinates for d1ebof_ are not available.

Timeline for d1ebof_:

• d1ebof_ first appeared (with stable ids) in SCOP 1.55
  
• d1ebof_ appears in SCOP 1.59
  
• d1ebof_ appears in the current release, SCOPe 2.08, called d1ebof1