Lineage for d1eboe_ (1ebo E:)

  1. Root: SCOP 1.65
  2. 344849Class h: Coiled coil proteins [57942] (6 folds)
  3. 345566Fold h.3: Stalk segment of viral fusion proteins [58063] (2 superfamilies)
    core: trimeric coiled coil
  4. 345630Superfamily h.3.2: Virus ectodomain [58069] (1 family) (S)
  5. 345631Family h.3.2.1: Virus ectodomain [58070] (6 proteins)
  6. 345632Protein Core structure of Ebo gp2 [58076] (1 species)
  7. 345633Species Ebola virus [TaxId:205488] [58077] (2 PDB entries)
  8. 345641Domain d1eboe_: 1ebo E: [45761]

Details for d1eboe_

PDB Entry: 1ebo (more details), 3 Å

PDB Description: crystal structure of the ebola virus membrane-fusion subunit, gp2, from the envelope glycoprotein ectodomain

SCOP Domain Sequences for d1eboe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eboe_ h.3.2.1 (E:) Core structure of Ebo gp2 {Ebola virus}
qiedkieeilskiyhieneiarikkligeadglieglrqlanettqalqlflrattelrt
fsilnrkaidfllqrwggtchilgpdcriephdwtknitdkidqiihdfvd

SCOP Domain Coordinates for d1eboe_:

Click to download the PDB-style file with coordinates for d1eboe_.
(The format of our PDB-style files is described here.)

Timeline for d1eboe_: