SCOP 1.59: Domain d1eboe_: 1ebo E:

Lineage for d1eboe_ (1ebo E:)

1. Root: SCOP 1.59

2. Class h: Coiled coil proteins [57942] (5 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)

4. Superfamily h.3.2: Virus ectodomain [58069] (1 family)

5. Family h.3.2.1: Virus ectodomain [58070] (6 proteins)

6. Protein Core structure of Ebo gp2 [58076] (1 species)

7. Species Ebola virus [TaxId:205488] [58077] (2 PDB entries)

8. Domain d1eboe_: 1ebo E: [45761]

Details for d1eboe_

PDB Entry: 1ebo, 3 Å

PDB Description: crystal structure of the ebola virus membrane-fusion subunit, gp2, from the envelope glycoprotein ectodomain

SCOP Domain Sequences for d1eboe_:

Sequence; same for both SEQRES and ATOM records:

>d1eboe_ h.3.2.1 (E:) Core structure of Ebo gp2 {Ebola virus}
qiedkieeilskiyhieneiarikkligeadglieglrqlanettqalqlflrattelrt
fsilnrkaidfllqrwggtchilgpdcriephdwtknitdkidqiihdfvd

Timeline for d1eboe_:

• d1eboe_ first appeared (with stable ids) in SCOP 1.55
  
• d1eboe_ appears in SCOP 1.57
  
• d1eboe_ appears in SCOP 1.61
  
• d1eboe_ appears in the current release, SCOPe 2.08, called d1eboe1