Lineage for d1ebob_ (1ebo B:)

  1. Root: SCOP 1.61
  2. 205390Class h: Coiled coil proteins [57942] (5 folds)
  3. 205977Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
  4. 206041Superfamily h.3.2: Virus ectodomain [58069] (1 family) (S)
  5. 206042Family h.3.2.1: Virus ectodomain [58070] (6 proteins)
  6. 206043Protein Core structure of Ebo gp2 [58076] (1 species)
  7. 206044Species Ebola virus [TaxId:205488] [58077] (2 PDB entries)
  8. 206049Domain d1ebob_: 1ebo B: [45758]

Details for d1ebob_

PDB Entry: 1ebo (more details), 3 Å

PDB Description: crystal structure of the ebola virus membrane-fusion subunit, gp2, from the envelope glycoprotein ectodomain

SCOP Domain Sequences for d1ebob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebob_ h.3.2.1 (B:) Core structure of Ebo gp2 {Ebola virus}
qiedkieeilskiyhieneiarikkligeadglieglrqlanettqalqlflrattelrt
fsilnrkaidfllqrwggtchilgpdcriephdwtknitdkidqiihdfvdk

SCOP Domain Coordinates for d1ebob_:

Click to download the PDB-style file with coordinates for d1ebob_.
(The format of our PDB-style files is described here.)

Timeline for d1ebob_: