Lineage for d1ebob_ (1ebo B:)

  1. Root: SCOP 1.57
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
  4. Superfamily h.3.2: Virus ectodomain [58069] (1 family) (S)
  5. Family h.3.2.1: Virus ectodomain [58070] (5 proteins)
  6. Protein Core structure of Ebo gp2 [58076] (1 species)
  7. Species Ebola virus [TaxId:205488] [58077] (2 PDB entries)
  8. Domain d1ebob_: 1ebo B: [45758]

Details for d1ebob_

PDB Entry: 1ebo (more details), 3 Å

PDB Description: crystal structure of the ebola virus membrane-fusion subunit, gp2, from the envelope glycoprotein ectodomain

SCOP Domain Sequences for d1ebob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebob_ h.3.2.1 (B:) Core structure of Ebo gp2 {Ebola virus}
qiedkieeilskiyhieneiarikkligeadglieglrqlanettqalqlflrattelrt
fsilnrkaidfllqrwggtchilgpdcriephdwtknitdkidqiihdfvdk

SCOP Domain Coordinates for d1ebob_ are not available.

Timeline for d1ebob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1eboa_, d1eboc_, d1ebod_, d1eboe_, d1ebof_