SCOP 1.59: Domain d2ebob_: 2ebo B:

Lineage for d2ebob_ (2ebo B:)

1. Root: SCOP 1.59

2. Class h: Coiled coil proteins [57942] (5 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)

4. Superfamily h.3.2: Virus ectodomain [58069] (1 family)

5. Family h.3.2.1: Virus ectodomain [58070] (6 proteins)

6. Protein Core structure of Ebo gp2 [58076] (1 species)

7. Species Ebola virus [TaxId:205488] [58077] (2 PDB entries)

8. Domain d2ebob_: 2ebo B: [45755]

Details for d2ebob_

PDB Entry: 2ebo, 1.9 Å

PDB Description: core structure of gp2 from ebola virus

SCOP Domain Sequences for d2ebob_:

Sequence; same for both SEQRES and ATOM records:

>d2ebob_ h.3.2.1 (B:) Core structure of Ebo gp2 {Ebola virus}
glrqlanettqalqlflrattelrtfsilnrkaidfllqrwggtchilgpdcaiephdwt
knitdkidqiihdf

Timeline for d2ebob_:

• d2ebob_ first appeared (with stable ids) in SCOP 1.55
  
• d2ebob_ appears in SCOP 1.57
  
• d2ebob_ appears in SCOP 1.61
  
• d2ebob_ appears in the current release, SCOPe 2.08