Lineage for d2eboa_ (2ebo A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3042053Superfamily h.3.2: Virus ectodomain [58069] (2 families) (S)
  5. 3042054Family h.3.2.1: Virus ectodomain [58070] (9 proteins)
  6. 3042055Protein Core structure of Ebo gp2 [58076] (1 species)
  7. 3042056Species Ebola virus [TaxId:205488] [58077] (2 PDB entries)
  8. 3042057Domain d2eboa_: 2ebo A: [45754]
    complexed with cl

Details for d2eboa_

PDB Entry: 2ebo (more details), 1.9 Å

PDB Description: core structure of gp2 from ebola virus
PDB Compounds: (A:) ebola virus envelope glycoprotein

SCOPe Domain Sequences for d2eboa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eboa_ h.3.2.1 (A:) Core structure of Ebo gp2 {Ebola virus [TaxId: 205488]}
glrqlanettqalqlflrattelrtfsilnrkaidfllqrwggtchilgpdcaiephdwt
knitdkidqiihdf

SCOPe Domain Coordinates for d2eboa_:

Click to download the PDB-style file with coordinates for d2eboa_.
(The format of our PDB-style files is described here.)

Timeline for d2eboa_: