Lineage for d1mg1a2 (1mg1 A:371-455)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2646635Superfamily h.3.2: Virus ectodomain [58069] (2 families) (S)
  5. 2646636Family h.3.2.1: Virus ectodomain [58070] (9 proteins)
  6. 2646670Protein HTLV-1 gp21 [58074] (1 species)
  7. 2646671Species Human T-cell leukemia virus type 1 [TaxId:11908] [58075] (1 PDB entry)
  8. 2646672Domain d1mg1a2: 1mg1 A:371-455 [45753]
    Other proteins in same PDB: d1mg1a1
    chimera with MBP
    complexed with cl, mal

Details for d1mg1a2

PDB Entry: 1mg1 (more details), 2.5 Å

PDB Description: htlv-1 gp21 ectodomain/maltose-binding protein chimera
PDB Compounds: (A:) protein (htlv-1 gp21 ectodomain/maltose-binding protein chimera)

SCOPe Domain Sequences for d1mg1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mg1a2 h.3.2.1 (A:371-455) HTLV-1 gp21 {Human T-cell leukemia virus type 1 [TaxId: 11908]}
amslasgksllhevdkdisqltqaivknhknllkiaqyaaqnrrgldllfweqgglckal
qeqccflnitnshvsilqerpplen

SCOPe Domain Coordinates for d1mg1a2:

Click to download the PDB-style file with coordinates for d1mg1a2.
(The format of our PDB-style files is described here.)

Timeline for d1mg1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mg1a1