SCOPe 2.01: Domain d1mg1a2: 1mg1 A:371-455

Lineage for d1mg1a2 (1mg1 A:371-455)

1. Root: SCOPe 2.01

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.2: Virus ectodomain [58069] (1 family)

5. Family h.3.2.1: Virus ectodomain [58070] (9 proteins)

6. Protein HTLV-1 gp21 [58074] (1 species)

7. Species Human T-cell leukemia virus type 1 [TaxId:11908] [58075] (1 PDB entry)

8. Domain d1mg1a2: 1mg1 A:371-455 [45753]
   Other proteins in same PDB: d1mg1a1
   chimera with MBP
   complexed with cl, mal

Details for d1mg1a2

PDB Entry: 1mg1, 2.5 Å

PDB Description: htlv-1 gp21 ectodomain/maltose-binding protein chimera

PDB Compounds: (A:) protein (htlv-1 gp21 ectodomain/maltose-binding protein chimera)

SCOPe Domain Sequences for d1mg1a2:

Sequence; same for both SEQRES and ATOM records:

>d1mg1a2 h.3.2.1 (A:371-455) HTLV-1 gp21 {Human T-cell leukemia virus type 1 [TaxId: 11908]}
amslasgksllhevdkdisqltqaivknhknllkiaqyaaqnrrgldllfweqgglckal
qeqccflnitnshvsilqerpplen

Timeline for d1mg1a2:

• d1mg1a2 first appeared (with stable ids) in SCOP 1.55
  
• d1mg1a2 appears in SCOP 1.75
  
• d1mg1a2 appears in SCOPe 2.02
  
• d1mg1a2 appears in the current release, SCOPe 2.08