Lineage for d1qcec_ (1qce C:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3042053Superfamily h.3.2: Virus ectodomain [58069] (2 families) (S)
  5. 3042054Family h.3.2.1: Virus ectodomain [58070] (9 proteins)
  6. 3042100Protein Retrovius gp41 protease-resistant core [58071] (4 species)
    coiled coil; biological unit: trimer
  7. 3042148Species Simian immunodeficiency virus [TaxId:11723] [58073] (10 PDB entries)
  8. 3042170Domain d1qcec_: 1qce C: [45752]
    ectodomain

Details for d1qcec_

PDB Entry: 1qce (more details)

PDB Description: solution nmr structure of ectodomain of siv gp41, restrained regularized mean structure plus 29 simulated annealing structures
PDB Compounds: (C:) protein (gp41)

SCOPe Domain Sequences for d1qcec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcec_ h.3.2.1 (C:) Retrovius gp41 protease-resistant core {Simian immunodeficiency virus [TaxId: 11723]}
aqsrtllagivqqqqqlldvvkrqqellrltvwgtknlqtrvtaiekylkdqaqlnawga
afrqvahttvpwpnasltpkwnnetwqewerkvdfleenitalleeaqiqqeknmyelqk
lns

SCOPe Domain Coordinates for d1qcec_:

Click to download the PDB-style file with coordinates for d1qcec_.
(The format of our PDB-style files is described here.)

Timeline for d1qcec_: