Lineage for d1qceb_ (1qce B:)

  1. Root: SCOP 1.55
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
  4. Superfamily h.3.2: Virus ectodomain [58069] (1 family) (S)
  5. Family h.3.2.1: Virus ectodomain [58070] (5 proteins)
  6. Protein Retrovius gp41 protease-resistant core [58071] (2 species)
  7. Species Simian immunodeficiency virus [58073] (8 PDB entries)
  8. Domain d1qceb_: 1qce B: [45751]

Details for d1qceb_

PDB Entry: 1qce (more details)

PDB Description: solution nmr structure of ectodomain of siv gp41, restrained regularized mean structure plus 29 simulated annealing structures

SCOP Domain Sequences for d1qceb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qceb_ h.3.2.1 (B:) Retrovius gp41 protease-resistant core {Simian immunodeficiency virus}
aqsrtllagivqqqqqlldvvkrqqellrltvwgtknlqtrvtaiekylkdqaqlnawga
afrqvahttvpwpnasltpkwnnetwqewerkvdfleenitalleeaqiqqeknmyelqk
lns

SCOP Domain Coordinates for d1qceb_ are not available.

Timeline for d1qceb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qcea_, d1qcec_