Lineage for d2ezob_ (2ezo B:)

  1. Root: SCOP 1.55
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
  4. Superfamily h.3.2: Virus ectodomain [58069] (1 family) (S)
  5. Family h.3.2.1: Virus ectodomain [58070] (5 proteins)
  6. Protein Retrovius gp41 protease-resistant core [58071] (2 species)
  7. Species Simian immunodeficiency virus [58073] (8 PDB entries)
  8. Domain d2ezob_: 2ezo B: [45748]

Details for d2ezob_

PDB Entry: 2ezo (more details)

PDB Description: solution nmr structure of ectodomain of siv gp41, restrained regularized mean structure

SCOP Domain Sequences for d2ezob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ezob_ h.3.2.1 (B:) Retrovius gp41 protease-resistant core {Simian immunodeficiency virus}
aqsrtllagivqqqqqlldvvkrqqellrltvwgtknlqtrvtaiekylkdqaqlnawga
afrqvahttvpwpnasltpkwnnetwqewerkvdfleenitalleeaqiqqeknmyelqk
lns

SCOP Domain Coordinates for d2ezob_ are not available.

Timeline for d2ezob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ezoa_, d2ezoc_