SCOP 1.55: Domain d2ezsc_: 2ezs C:

Lineage for d2ezsc_ (2ezs C:)

1. Root: SCOP 1.55
2. Class h: Coiled coil proteins [57942] (5 folds)
3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
4. Superfamily h.3.2: Virus ectodomain [58069] (1 family)
5. Family h.3.2.1: Virus ectodomain [58070] (5 proteins)
6. Protein Retrovius gp41 protease-resistant core [58071] (2 species)
7. Species Simian immunodeficiency virus [58073] (8 PDB entries)
8. Domain d2ezsc_: 2ezs C: [45746]

Details for d2ezsc_

PDB Entry: 2ezs

PDB Description: solution nmr structure of ectodomain of siv gp41, models 31-40 of an ensemble of 40 simulated annealing structures

SCOP Domain Sequences for d2ezsc_:

Sequence; same for both SEQRES and ATOM records:

>d2ezsc_ h.3.2.1 (C:) Retrovius gp41 protease-resistant core {Simian immunodeficiency virus}
aqsrtllagivqqqqqlldvvkrqqellrltvwgtknlqtrvtaiekylkdqaqlnawga
afrqvahttvpwpnasltpkwnnetwqewerkvdfleenitalleeaqiqqeknmyelqk
lns

SCOP Domain Coordinates for d2ezsc_ are not available.

Timeline for d2ezsc_:

• d2ezsc_ appears in SCOP 1.57
  
• d2ezsc_ appears in the current release, SCOPe 2.08