Lineage for d2ezrc_ (2ezr C:)

  1. Root: SCOP 1.55
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
  4. Superfamily h.3.2: Virus ectodomain [58069] (1 family) (S)
  5. Family h.3.2.1: Virus ectodomain [58070] (5 proteins)
  6. Protein Retrovius gp41 protease-resistant core [58071] (2 species)
  7. Species Simian immunodeficiency virus [58073] (8 PDB entries)
  8. Domain d2ezrc_: 2ezr C: [45743]

Details for d2ezrc_

PDB Entry: 2ezr (more details)

PDB Description: solution nmr structure of ectodomain of siv gp41, models 21-30 of an ensemble of 40 simulated annealing structures

SCOP Domain Sequences for d2ezrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ezrc_ h.3.2.1 (C:) Retrovius gp41 protease-resistant core {Simian immunodeficiency virus}
aqsrtllagivqqqqqlldvvkrqqellrltvwgtknlqtrvtaiekylkdqaqlnawga
afrqvahttvpwpnasltpkwnnetwqewerkvdfleenitalleeaqiqqeknmyelqk
lns

SCOP Domain Coordinates for d2ezrc_ are not available.

Timeline for d2ezrc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ezra_, d2ezrb_