SCOP 1.55: Domain d2ezqb_: 2ezq B:

Lineage for d2ezqb_ (2ezq B:)

1. Root: SCOP 1.55
2. Class h: Coiled coil proteins [57942] (5 folds)
3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
4. Superfamily h.3.2: Virus ectodomain [58069] (1 family)
5. Family h.3.2.1: Virus ectodomain [58070] (5 proteins)
6. Protein Retrovius gp41 protease-resistant core [58071] (2 species)
7. Species Simian immunodeficiency virus [58073] (8 PDB entries)
8. Domain d2ezqb_: 2ezq B: [45739]

Details for d2ezqb_

PDB Entry: 2ezq

PDB Description: solution nmr structure of ectodomain of siv gp41, models 11-20 of an ensemble of 40 simulated annealing structures

SCOP Domain Sequences for d2ezqb_:

Sequence; same for both SEQRES and ATOM records:

>d2ezqb_ h.3.2.1 (B:) Retrovius gp41 protease-resistant core {Simian immunodeficiency virus}
aqsrtllagivqqqqqlldvvkrqqellrltvwgtknlqtrvtaiekylkdqaqlnawga
afrqvahttvpwpnasltpkwnnetwqewerkvdfleenitalleeaqiqqeknmyelqk
lns

SCOP Domain Coordinates for d2ezqb_ are not available.

Timeline for d2ezqb_:

• d2ezqb_ appears in SCOP 1.57
  
• d2ezqb_ appears in the current release, SCOPe 2.08