Lineage for d1df5a_ (1df5 A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3042053Superfamily h.3.2: Virus ectodomain [58069] (2 families) (S)
  5. 3042054Family h.3.2.1: Virus ectodomain [58070] (9 proteins)
  6. 3042100Protein Retrovius gp41 protease-resistant core [58071] (4 species)
    coiled coil; biological unit: trimer
  7. 3042101Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (26 PDB entries)
  8. 3042146Domain d1df5a_: 1df5 A: [45727]

Details for d1df5a_

PDB Entry: 1df5 (more details), 2.7 Å

PDB Description: interactions between hiv-1 gp41 core and detergents and their implications for membrane fusion
PDB Compounds: (A:) hiv-1 envelope glycoprotein gp41

SCOPe Domain Sequences for d1df5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1df5a_ h.3.2.1 (A:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
sgivqqqnnllraieaqqhllqltvwgikqlqarsggrggwmewdreinnytslihslie
esqnqqek

SCOPe Domain Coordinates for d1df5a_:

Click to download the PDB-style file with coordinates for d1df5a_.
(The format of our PDB-style files is described here.)

Timeline for d1df5a_: