SCOPe 2.08: Domain d1df5a_: 1df5 A:

Lineage for d1df5a_ (1df5 A:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.2: Virus ectodomain [58069] (2 families)

5. Family h.3.2.1: Virus ectodomain [58070] (9 proteins)

6. Protein Retrovius gp41 protease-resistant core [58071] (4 species)
   coiled coil; biological unit: trimer

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (26 PDB entries)

8. Domain d1df5a_: 1df5 A: [45727]

Details for d1df5a_

PDB Entry: 1df5, 2.7 Å

PDB Description: interactions between hiv-1 gp41 core and detergents and their implications for membrane fusion

PDB Compounds: (A:) hiv-1 envelope glycoprotein gp41

SCOPe Domain Sequences for d1df5a_:

Sequence; same for both SEQRES and ATOM records:

>d1df5a_ h.3.2.1 (A:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
sgivqqqnnllraieaqqhllqltvwgikqlqarsggrggwmewdreinnytslihslie
esqnqqek

Timeline for d1df5a_:

• d1df5a_ first appeared (with stable ids) in SCOP 1.55
  
• d1df5a_ appears in SCOPe 2.07